PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Tp7g14610
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassicaceae incertae sedis; Schrenkiella
Family GATA
Protein Properties Length: 198aa    MW: 21358.1 Da    PI: 10.6662
Description GATA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Tp7g14610genomethellungiellaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GATA55.11e-173771135
       GATA  1 CsnCgttkTplWRrgpdgnktLCnaCGlyyrkkgl 35
               C+ Cgt  TplWR gp g+k+LCnaCG++ rkk++
  Tp7g14610 37 CVDCGTNRTPLWRGGPAGPKSLCNACGIKSRKKRQ 71
               *********************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004015.3E-103183IPR000679Zinc finger, GATA-type
PROSITE profilePS5011412.0313186IPR000679Zinc finger, GATA-type
SuperFamilySSF577161.52E-113271No hitNo description
Gene3DG3DSA:3.30.50.103.5E-143571IPR013088Zinc finger, NHR/GATA-type
CDDcd002021.55E-103670No hitNo description
PROSITE patternPS0034403762IPR000679Zinc finger, GATA-type
PfamPF003201.6E-153771IPR000679Zinc finger, GATA-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0008270Molecular Functionzinc ion binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 198 aa     Download sequence    Send to blast
MTEETKTTKF ESAGDSSDVD NGNCSSSGSG GDTKKTCVDC GTNRTPLWRG GPAGPKSLCN  60
ACGIKSRKKR QAALGIRQED NKIKNKSNNN LALDNQTVKN GKGDSGIVKN KIKTTRDAES  120
FKNGKSDQGS VKNRIKTTDA ENLSSGGNKK NVKRASRFLD LGFKVPAMKR SAVEKKRIWR  180
KLGEEERAAV LLMTLSCG
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK1190211e-100AK119021.1 Arabidopsis thaliana At4g16141 mRNA for unknown protein, complete cds, clone: RAFL21-34-K14.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006414388.12e-94hypothetical protein EUTSA_v10026300mg
SwissprotQ9LIB53e-60GAT17_ARATH; GATA transcription factor 17
TrEMBLV4P8912e-94V4P891_EUTSA; Uncharacterized protein
STRINGAT4G16141.17e-83(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM138161624
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G16141.12e-78GATA family protein